Biotinylated Recombinant Human IL-3RA/CD123 Protein
Product Sizes
100 ug
£657.00
RP00444B-100UG
About this Product
- SKU:
- RP00444B
- Additional Names:
- CD123|IL-3 R alpha|IL-3R subunit alpha|IL-3Ra|IL3R|IL3RA|IL3RAY|IL3RX|IL3RY|MGC34174
- Conjugate:
- Biotin
- Extra Details:
- Biotinylated Recombinant Human IL-3RA/CD123 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr19-Arg305) of Human IL-3 R alpha/CD123 (Accession #P26951-1) fused with a C-His&Avi tag at the C-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Thr19-Arg305
- Molecular Weight:
- 35.99 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Conjugated Protein
- Manufacturer's Data Sheet:RP00444B
