Biotinylated Recombinant Human IL-15RA/CD215 Protein
Product Sizes
100 ug
£657.00
RP00436B-100UG
500 ug
£1954.00
RP00436B-500UG
1000 ug
£3382.00
RP00436B-1000UG
About this Product
- SKU:
- RP00436B
- Additional Names:
- CD215|IL-15 R alpha|IL-15RA|MGC104179
- Conjugate:
- Biotin
- Extra Details:
- Interleukin-15 receptor alpha (IL-15R alpha) is a high affinity IL-15 binding protein that is crucial for mediating IL-15 functions such as memory CD8 T cell proliferation and NK, NK/T cell, and intestinal intraepithelial lymphocyte development.
- Formulation:
- Biotinylated Recombinant Human IL-15RA/CD215 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile31-Thr205) of Human IL-15RA/IL-15 R alpha/CD215 (A
- Immunogen:
- Ile31-Thr205
- Molecular Weight:
- 50-70 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Conjugated Protein
- Manufacturer's Data Sheet:RP00436B
