Biotinylated Recombinant Human TROP-2/TACSTD2 Protein
Product Sizes
100 ug
£657.00
RP00421B-100UG
About this Product
- SKU:
- RP00421B
- Additional Names:
- EGP-1|EGP1|GA733-1|gp50|M1S1|T16|TACD2|TACSTD2|TROP-2|TROP2
- Conjugate:
- Biotin
- Extra Details:
- Biotinylated Recombinant Human TROP-2/TACSTD2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His27-Thr274) of Human TROP-2/TACSTD2 (Accession #P09758) fused with a C-His&Avi tag at the C-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- His27-Thr274
- Molecular Weight:
- 30.5 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Conjugated Protein
- Manufacturer's Data Sheet:RP00421B
