Recombinant Human NKG2-D/KLRK1/CD314 Protein

Product Sizes

10 ug

£145.00

RP00417-10UG

50 ug

£336.00

RP00417-50UG

500 ug

£2050.00

RP00417-500UG

1000 ug

£2430.00

RP00417-1000UG

About this Product

SKU:: RP00417
Additional Names:: CD314|KLR|NKG2-D|NKG2D
Extra Details:: This protein represents naturally occurring read-through transcription between the neighboring KLRC4 (killer cell lectin-like receptor subfamily C, member 4) and KLRK1 (killer cell lectin-like receptor subfamily K, member 1) genes on chromosome 12. The read-through transcript includes an alternate 5' exon and lacks a significant portion of the KLRC4 coding sequence, including the start codon, and it thus encodes the KLRK1 protein.
Formulation:: Recombinant Human NKG2-D/KLRK1/CD314 Protein is produced by Human cell expression system. The target protein is expressed with sequence (Phe78-Val216) of human NKG2D/CD314/KLRK1 (Accession #P26718) fu
Immunogen:: Phe78-Val216
Molecular Weight:: 20-33 kDa
Physical State:: Lyophilized
Purity:: ≥95%
Sequence:: FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: ABclonal Technology
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins

Basket