Recombinant Human NKG2-D/KLRK1/CD314 Protein
Product Sizes
10 ug
£145.00
RP00417-10UG
50 ug
£336.00
RP00417-50UG
About this Product
- SKU:
- RP00417
- Additional Names:
- CD314|KLR|NKG2-D|NKG2D
- Extra Details:
- Recombinant Human NKG2-D/KLRK1/CD314 Protein is produced by Human cell expression system. The target protein is expressed with sequence (Phe78-Val216) of human NKG2D/CD314/KLRK1 (Accession #P26718) fused with a 6xHis tag at the N-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Phe78-Val216
- Molecular Weight:
- 16.9 kda
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00417
