Biotinylated Recombinant Human CEACAM6/CD66c Protein

Product Sizes

100 ug

£657.00

RP00413B-100UG

500 ug

£1954.00

RP00413B-500UG

1000 ug

£3382.00

RP00413B-1000UG

About this Product

SKU:: RP00413B
Additional Names:: CD66c|CEA|CEACAM6|CEAL|NCA
Conjugate:: Biotin
Extra Details:: Carcinoembryonic antigen-related cell adhesion molecule 6 (CEACAM6) belongs to the human carcino-embryonic antigen (CEA) family. Numerous lines of studies have indicated that altered expression of CEACAM6 may have a role in carcinogenesis and development.
Formulation:: Biotinylated Recombinant Human CEACAM6/CD66c Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Lys35-Gly320) of Human CEACAM6/CD66c (Accession #P401
Immunogen:: Lys35-Gly320
Molecular Weight:: 55-75 kDa
Physical State:: Lyophilized
Purity:: ≥ 95 % as determined by SDS-PAGE;≥ 95 %
Sequence:: KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: ABclonal Technology
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins

Basket