Recombinant Human IL-37/IL-1F7 Protein
Product Sizes
10 ug
£145.00
RP00409-10UG
20 ug
£193.00
RP00409-20UG
50 ug
£288.00
RP00409-50UG
100 ug
£431.00
RP00409-100UG
500 ug
£1240.00
RP00409-500UG
1000 ug
£1954.00
RP00409-1000UG
About this Product
- SKU:
- RP00409
- Additional Names:
- IL37,FIL1,FIL1(ZETA),FIL1Z,IL-1F7,IL-1H,IL-1H4,IL-1RP1,IL-37,IL1F7,IL1H4,IL1RP1
- Extra Details:
- This protein is a member of the interleukin 1 cytokine family. This cytokine can bind to, and may be a ligand for interleukin 18 receptor (IL18R1/IL-1Rrp). This cytokine also binds to interleukin 18 binding protein (IL18BP), an inhibitory binding protein of interleukin 18 (IL18), and subsequently forms a complex with IL18 receptor beta subunit, and through which it inhibits the activity of IL18. This gene along with eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Five alternatively spliced transcript variants encoding distinct isoforms have been reported.
- Formulation:
- Recombinant Human IL-37/IL-1F7 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Lys27-Asp192) of human Interleukin-37/IL-37 (Accession #Q9NZH6-2) fused
- Immunogen:
- Lys27-Asp192
- Molecular Weight:
- 18 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- NLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00409
