Recombinant Human PVR/CD155 Protein
Product Sizes
100 ug
£353.00
RP00389-100UG
500 ug
£1002.00
RP00389-500UG
1000 ug
£1954.00
RP00389-1000UG
About this Product
- SKU:
- RP00389
- Additional Names:
- CD155|FLJ25946|HVED|Necl-5|NECL5|nectin-like 5|PVR|PVS|PVSFLJ25946|Tage4
- Extra Details:
- CD155 is a cell surface adhesion molecule functioning in tumor cell migration, invasion, and metastasis, and not surprisingly, is also designated as a common tumor-associated antigen. CD155 is also recognized by NK cells to induce their cytotoxicity. CD155 is also commonly referred to as the "poliovirus receptor," or PVR.
- Formulation:
- Recombinant Human PVR/CD155 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Trp21-Asn343) of Human PVR/CD155 (Accession #P15151-1) fused with a C-
- Immunogen:
- Trp21-Asn343
- Molecular Weight:
- 55-70 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00389
