Biotinylated Recombinant Human Nectin-2/PVRL2/CD112 Protein

Product Sizes

100 ug

£657.00

RP00383B-100UG

500 ug

£1954.00

RP00383B-500UG

1000 ug

£3382.00

RP00383B-1000UG

About this Product

SKU:: RP00383B
Additional Names:: CD112|HVEB|MPH|Nectin2|PRR2|PVRL2|PVRR2
Conjugate:: Biotin
Extra Details:: Nectin-2 is an adhesion molecule that has been reported to play a role in tumor growth, metastasis and tumor angiogenesis. Nectin-2 expression in ovarian cancer may support tumor cell adhesion, leading to growth and lymph node metastasis. Effect of VEGF on Nectin-2 expression as well as permeability was investigated in HUVEC.
Formulation:: Biotinylated Recombinant Human Nectin-2/CD112 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln32-Leu360) of Human Nectin-2/CD112 (Accession #Q9
Immunogen:: Gln32-Leu360
Molecular Weight:: 45-50 kDa
Physical State:: Lyophilized
Purity:: ≥ 95 % as determined by SDS-PAGE;≥ 95 %
Sequence:: QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPRASPRDVGPL
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: ABclonal Technology
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins

Basket