Recombinant Human Nectin-2/PVRL2/CD112 Protein
Product Sizes
100 ug
£336.00
RP00381-100UG
About this Product
- SKU:
- RP00381
- Additional Names:
- CD112|HVEB|MPH|Nectin2|PRR2|PVRL2|PVRR2
- Extra Details:
- Recombinant Human Nectin-2/PVRL2/CD112 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln32-Leu360) of Human Nectin-2/PVRL2/CD112 (Accession #Q92692-2) fused with No Tag.
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Gln32-Leu360
- Molecular Weight:
- 35.54 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPRASPRDVGPL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00381




