Recombinant Human E-Selectin/SELE/CD62E Protein
Product Sizes
100 ug
£336.00
RP00377-100UG
500 ug
£907.00
RP00377-500UG
1000 ug
£1574.00
RP00377-1000UG
About this Product
- SKU:
- RP00377
- Additional Names:
- CD62E|E-Selectin|ELAM|ELAM1|ESEL|LECAM2|RP1-117P20.2|SELE|selectin E
- Extra Details:
- E-Selectin (Endothelial Leukocyte Adhesion Molecule-1, ELAM-1, CD62E), a member of the Selectin family, is a 107 - 115 kDa cell surface glycoprotein. It is transiently expressed on vascular endothelial cells in response to IL-1 beta and TNF-alpha.E-selectin mediates in the adhesion of blood neutrophils in cytokine-activated endothelium through interaction with SELPLG/PSGL1. May have a role in capillary morphogenesis.
- Formulation:
- Recombinant Human E-Selectin/SELE/CD62E Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Trp22-Pro556) of Human E-Selectin/SELE/CD62E (Accession #P
- Immunogen:
- Trp22-Pro556
- Molecular Weight:
- 90-130 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Lectins
- Manufacturer's Data Sheet:RP00377
