Recombinant Human Follistatin/Follistatin 288/FST Protein
Product Sizes
10 ug
£145.00
RP00376-10UG
20 ug
£193.00
RP00376-20UG
50 ug
£288.00
RP00376-50UG
100 ug
£395.00
RP00376-100UG
500 ug
£1157.00
RP00376-500UG
1000 ug
£1812.00
RP00376-1000UG
About this Product
- SKU:
- RP00376
- Additional Names:
- FST,FS
- Extra Details:
- Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicing of the precursor mRNA. In a study in which 37 candidate genes were tested for linkage and association with polycystic ovary syndrome (PCOS) or hyperandrogenemia in 150 families, evidence was found for linkage between PCOS and follistatin.
- Formulation:
- Recombinant Human Follistatin/Follistatin 288/FST Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly30-Asn317) of human Follistatin/Follistatin 2
- Immunogen:
- Gly30-Asn317
- Molecular Weight:
- 95-140 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVC
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00376
