Recombinant Human Follistatin/Follistatin 288/FST Protein
Product Sizes
10 ug
£145.00
RP00376-10UG
20 ug
£193.00
RP00376-20UG
50 ug
£288.00
RP00376-50UG
100 ug
£395.00
RP00376-100UG
About this Product
- SKU:
- RP00376
- Additional Names:
- FST,FS
- Extra Details:
- Recombinant Human Follistatin/Follistatin 288/FST Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly30-Asn317) of human Follistatin/Follistatin 288/FST (Accession #P19883) with a hFC at the N-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Gly30-Asn317
- Molecular Weight:
- 54.19 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVC
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00376
