Biotinylated Recombinant Human TNFRSF4/OX40/CD134 Protein

Product Sizes

100 ug

£657.00

RP00363B-100UG

500 ug

£1954.00

RP00363B-500UG

1000 ug

£3858.00

RP00363B-1000UG

About this Product

SKU:: RP00363B
Additional Names:: ACT-135|CD134|IMD16|Ly-70|OX40|OX40 homologue|OX40L receptor|TNFRSF4|TXGP1L
Conjugate:: Biotin
Extra Details:: Tumor necrosis factor receptor superfamily, member 4 (TNFRSF4), also known as CD134 and OX40 receptor. OX40 is a secondary co-stimulatory immune checkpoint molecule, expressed after 24 to 72 hours following activation; its ligand, OX40L, is also not expressed on resting antigen presenting cells, but is following their activation.
Formulation:: Biotinylated Recombinant Human TNFRSF4/OX40/CD134 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu29-Ala216) of Human OX40/TNFRSF4/CD134 (Acces
Immunogen:: Leu29-Ala216
Molecular Weight:: 50-55 kDa
Physical State:: Lyophilized
Purity:: ≥ 95 % as determined by SDS-PAGE;≥ 95 %
Sequence:: LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: ABclonal Technology
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Conjugated Protein

Basket