Recombinant Human TNFRSF4/OX40/CD134 Protein

Product Sizes

100 ug

£336.00

RP00362-100UG

500 ug

£1002.00

RP00362-500UG

1000 ug

£1764.00

RP00362-1000UG

About this Product

SKU:: RP00362
Additional Names:: ACT-135|CD134|IMD16|Ly-70|OX40|OX40 homologue|OX40L receptor|TNFRSF4|TXGP1L
Extra Details:: Tumor necrosis factor receptor superfamily, member 4 (TNFRSF4), also known as CD134 and OX40 receptor. OX40 is a secondary co-stimulatory immune checkpoint molecule, expressed after 24 to 72 hours following activation; its ligand, OX40L, is also not expressed on resting antigen presenting cells, but is following their activation.
Formulation:: Recombinant Human TNFRSF4/OX40/CD134 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu29-Ala216) of Human OX40/TNFRSF4/CD134 (Accession #P43489)
Immunogen:: Leu29-Ala216
Molecular Weight:: 70-78 kDa
Physical State:: Lyophilized
Purity:: ≥95%
Sequence:: LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: ABclonal Technology
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins

Basket