Recombinant Human TNFSF9/4-1BB Ligand Trimer Protein
Product Sizes
100 ug
£395.00
RP00361-100UG
500 ug
£1157.00
RP00361-500UG
1000 ug
£2258.00
RP00361-1000UG
About this Product
- SKU:
- RP00361
- Additional Names:
- 4-1BB Ligand|4-1BBL|41BB Ligand|CD137L|TNFSF9
- Extra Details:
- The 4-1BBL is the high affinity ligand of 4-1BB, also known as CD137L or TNFSF9. 4-1BB ligand (4-1BBL) is an inducible molecule present on several APC types, including B cells, macrophages and DCs.4-1BB:4-1BBL pathway seems to amplify the existing costimulatory signals, even if the engagement of 4-1BB in the presence of a strong TCR signaling can induce IL-2 production in a CD28-independent manner.
- Formulation:
- Recombinant Human TNFSF9/4-1BB Ligand Trimer Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg71-Glu254) of Human TNFSF9/4-1BB Ligand Trimer (Ac
- Immunogen:
- Arg71-Glu254
- Molecular Weight:
- 61 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00361
