Recombinant Human TNFSF9/4-1BB Ligand Trimer Protein
Product Sizes
100 ug
£395.00
RP00360-100UG
About this Product
- SKU:
- RP00360
- Additional Names:
- 4-1BB Ligand|4-1BBL|41BB Ligand|CD137L|TNFSF9
- Extra Details:
- Recombinant Human TNFSF9/4-1BB Ligand Trimer Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg71-Glu254) of Human TNFSF9/4-1BB Ligand Trimer (Accession #P41273) fused with a N-monomeric hFc tag at the N-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Arg71-Glu254
- Molecular Weight:
- 84.3 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00360




