Recombinant Human CXCL9/MIG Protein
Product Sizes
10 ug
£163.00
RP00352-10UG
50 ug
£336.00
RP00352-50UG
100 ug
£508.00
RP00352-100UG
500 ug
£1478.00
RP00352-500UG
1000 ug
£2335.00
RP00352-1000UG
About this Product
- SKU:
- RP00352
- Additional Names:
- CXCL9,CMK,Humig,MIG,SCYB9,crg-10
- Extra Details:
- This antimicrobial protein belongs a protein thought to be involved in T cell trafficking. The encoded protein binds to C-X-C motif chemokine 3 and is a chemoattractant for lymphocytes but not for neutrophils.
- Formulation:
- Recombinant Human CXCL9/MIG Protein is produced by E. coli expression system. The target protein is expressed with sequence (Thr23-Thr125) of human CXCL9 (Accession #Q07325) fused with no additional a
- Immunogen:
- Thr23-Thr125
- Molecular Weight:
- 15-25 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00352
