Recombinant Human CXCL5/ENA-70 Protein
Product Sizes
10 ug
£145.00
RP00351-10UG
20 ug
£193.00
RP00351-20UG
50 ug
£288.00
RP00351-50UG
100 ug
£431.00
RP00351-100UG
500 ug
£1240.00
RP00351-500UG
1000 ug
£1954.00
RP00351-1000UG
About this Product
- SKU:
- RP00351
- Additional Names:
- CXCL5,ENA-78,SCYB5
- Extra Details:
- This protein belongs a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This protein is proposed to bind the G-protein coupled receptor chemokine (C-X-C motif) receptor 2 to recruit neutrophils, to promote angiogenesis and to remodel connective tissues. This protein is thought to play a role in cancer cell proliferation, migration, and invasion.
- Formulation:
- Recombinant Human CXCL5/ENA-70 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala37-Asn114) of human CXCL5/ENA-70 (Accession #P42830) fused with
- Immunogen:
- Ala37-Asn114
- Molecular Weight:
- 15-20 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00351
