Recombinant Human NKp46/NCR1/CD335 Protein
Product Sizes
100 ug
£395.00
RP00347-100UG
500 ug
£1157.00
RP00347-500UG
1000 ug
£2258.00
RP00347-1000UG
About this Product
- SKU:
- RP00347
- Additional Names:
- CD335|Ly94|MAR-1|NCR1|NKp46|NKP46FLJ99094
- Extra Details:
- NKp46, along with NKp30 and NKp44, are activating receptors that have been collectively termed the natural cytotoxicity receptors (NCR).These receptors lack significant sequence homology to one another. They are expressed almost exclusively by NK cells and play a major role in triggering some of the key lytic activities of NK cells.
- Formulation:
- Recombinant Human NKp46/NCR1/CD335 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln22-Asn255) of Human NKp46/NCR1/CD335 (Accession #O76036-1) f
- Immunogen:
- Gln22-Asn255
- Molecular Weight:
- 68-70 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- QQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00347
