Recombinant Human LILRB2/ILT-4/CD85d Domain1&2 Protein
Product Sizes
100 ug
£353.00
RP00340-100UG
About this Product
- SKU:
- RP00340
- Additional Names:
- CD85d|ILT-4|ILT4|ILT4CD85d|LILRB2|LIR2|MIR10
- Extra Details:
- Recombinant Human LILRB2/ILT-4/CD85d Domain1&2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln22-Val229) of Human LILRB2/CD85d/ILT4 Domain1&2 (Accession #Q8N423-1) fused with a C-His tag at the C-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Gln22-Val229
- Molecular Weight:
- 24.2 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- QTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00340
