Biotinylated Recombinant Human DNAM-1/CD226 Protein

Product Sizes

100 ug

£657.00

RP00336B-100UG

500 ug

£1954.00

RP00336B-500UG

1000 ug

£3382.00

RP00336B-1000UG

About this Product

SKU:: RP00336B
Additional Names:: CD226|CD226 molecule|DNAM1|PTA1|TLiSA1
Conjugate:: Biotin
Extra Details:: DNAX accessory molecule-1 (DNAM-1), also known as CD226, is a 65 kDa type I transmembrane glycoprotein in the immunoglobulin superfamily.DNAM-1 mediates cellular adhesion to other cells bearing its ligands, CD112 and CD155, and cross-linking DNAM-1 with antibodies causes cellular activation. Furthermore, DNAM-1 can interact with PVR and PVRL2.
Formulation:: Biotinylated Recombinant Human DNAM-1/CD226 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu19-Asn247) of Human DNAM-1/CD226 (Accession #Q15762
Immunogen:: Glu19-Asn247
Molecular Weight:: 50-70 kDa
Physical State:: Lyophilized
Purity:: ≥ 95 % as determined by SDS-PAGE;≥ 95 %
Sequence:: EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDN
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: ABclonal Technology
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins

Basket