Recombinant Human TREM2 Protein
Product Sizes
100 ug
£353.00
RP00322-100UG
500 ug
£1002.00
RP00322-500UG
1000 ug
£1954.00
RP00322-1000UG
About this Product
- SKU:
- RP00322
- Additional Names:
- B7-H|B7-H1|B7H1|CD274|PD-L1|PD-L1B7 homolog 1|PDCD1L1|PDCD1LG1|PDL1
- Extra Details:
- TREM-2 (Triggering Receptor Expressed on Myeloid cells-2) is a 35 kDa type I transmembrane member of the TREM family and Ig superfamily. Mature human TREM-2? consists of a 156 amino acid (aa) extracellular domain (ECD) with one V-type Ig-like domain, a 21 aa transmembrane (TM) domain, and a 35 aa cytoplasmic tail. TREM-2 forms a receptor signaling complex with TYROBP which mediates signaling and cell activation following ligand binding (PubMed:10799849). Acts as a receptor for amyloid-beta protein 42, a cleavage product of the amyloid-beta precursor protein APP, and mediates its uptake and degradation by microglia.
- Formulation:
- Recombinant Human TREM2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His19-Ser174) of Human TREM2 (Accession #Q9NZC2-1) fused with a C-hFc tag
- Immunogen:
- His19-Ser174
- Molecular Weight:
- 50-70 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00322
