Recombinant Human TREM2 Protein
Product Sizes
100 ug
£353.00
RP00322-100UG
About this Product
- SKU:
- RP00322
- Additional Names:
- B7-H|B7-H1|B7H1|CD274|PD-L1|PD-L1B7 homolog 1|PDCD1L1|PDCD1LG1|PDL1
- Extra Details:
- Recombinant Human TREM2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His19-Ser174) of Human TREM2 (Accession #Q9NZC2-1) fused with a C-hFc tag at the C-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS, 100 mM Arginine (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- His19-Ser174
- Molecular Weight:
- 44.2 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00322
