Recombinant Human TREM-1/CD354 Protein
Product Sizes
100 ug
£395.00
RP00319-100UG
500 ug
£1157.00
RP00319-500UG
1000 ug
£2258.00
RP00319-1000UG
About this Product
- SKU:
- RP00319
- Additional Names:
- CD354|TREM-1
- Extra Details:
- TREM1 (Triggering Receptor Expressed on Myeloid Cells 1) is a pro-inflammatory receptor expressed by phagocytes, which can also be released as a soluble molecule (sTREM1). The roles of TREM1 and sTREM1 in liver infection and inflammation are not clear.
- Formulation:
- Recombinant Human TREM-1/CD354 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala21-Arg200) of Human TREM1 (Accession #Q9NP99) fused with a C-His
- Immunogen:
- Ala21-Arg200
- Molecular Weight:
- 40-60 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- ATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRDGEMPKTLACTERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPKEPHMLFDRIRLVVTKGFSGTPGSNENSTQNVYKIPPTTTKALCPLYTSPRTVTQAPPKSTADVSTPDSEINLTNVTDIIR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00319
