Recombinant Human CCL24/Eotaxin-2 Protein
Product Sizes
10 ug
£145.00
RP00318-10UG
20 ug
£193.00
RP00318-20UG
50 ug
£288.00
RP00318-50UG
100 ug
£431.00
RP00318-100UG
About this Product
- SKU:
- RP00318
- Additional Names:
- CCL24,Ckb-6,MPIF-2,MPIF2,SCYA24
- Extra Details:
- Recombinant Human CCL24/Eotaxin-2 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Val27-Cys119) of human CCL24/Eotaxin-2 (Accession #O00175) fused with no additional amino acid.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Val27-Cys119
- Molecular Weight:
- 10.47 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00318
