Recombinant Human CCL17/TARC Protein
Product Sizes
10 ug
£145.00
RP00315-10UG
20 ug
£193.00
RP00315-20UG
50 ug
£288.00
RP00315-50UG
100 ug
£431.00
RP00315-100UG
About this Product
- SKU:
- RP00315
- Additional Names:
- CCL17, SCYA17, TARC,C-C motif chemokine 17, CC chemokine TARC, Small-inducible cytokine A17, Thymus and activation-regulated chemokine
- Extra Details:
- Recombinant Recombinant Human CCL17/TARC Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala24-Ser94) of Human CCL17/TARC (Accession #NP_002978.1) fused with a His tag at the C-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Ala24-Ser94
- Molecular Weight:
- 8.92 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00315
