Recombinant Human SLAMF7/CRACC/CD319 Protein
Product Sizes
100 ug
£336.00
RP00305-100UG
500 ug
£907.00
RP00305-500UG
1000 ug
£1574.00
RP00305-1000UG
About this Product
- SKU:
- RP00305
- Additional Names:
- 19A|CD2 subset 1|CD319|CRACC|CS1|FOAP-12|Novel Ly9|SLAMF7
- Extra Details:
- CD2-like receptor activating cytotoxic cells (CRACC), also known as CS1, novel Ly9, SLAMF7, and CD319, is a 65-75 kDa type I transmembrane glycoprotein in the SLAM subgroup of the CD2 family.Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response.
- Formulation:
- Recombinant Human SLAMF7/CRACC/CD319 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser23-Met226) of Human SLAMF7/CRACC/CD319 (Accession #Q9NQ25-
- Immunogen:
- Ser23-Met226
- Molecular Weight:
- 40-55 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSM
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00305
