Recombinant Human E-selectin/SELE/CD62E Protein
Product Sizes
10 ug
£127.00
RP00293-10UG
20 ug
£157.00
RP00293-20UG
50 ug
£223.00
RP00293-50UG
100 ug
£336.00
RP00293-100UG
500 ug
£907.00
RP00293-500UG
1000 ug
£1478.00
RP00293-1000UG
About this Product
- SKU:
- RP00293
- Additional Names:
- SELE,CD62E,ELAM,ELAM1,ESEL,LECAM2
- Extra Details:
- The protein is found in cytokine-stimulated endothelial cells and is thought to be responsible for the accumulation of blood leukocytes at sites of inflammation by mediating the adhesion of cells to the vascular lining. It exhibits structural features such as the presence of lectin- and EGF-like domains followed by short consensus repeat (SCR) domains that contain 6 conserved cysteine residues. These proteins are part of the selectin family of cell adhesion molecules. Adhesion molecules participate in the interaction between leukocytes and the endothelium and appear to be involved in the pathogenesis of atherosclerosis.
- Formulation:
- Recombinant Human E-selectin/SELE/CD62E Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Trp22-Pro556) of human E-Selectin/CD62E (Accession #NP_000441.2)
- Immunogen:
- Trp22-Pro556
- Molecular Weight:
- 110-120 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Lectins
- Manufacturer's Data Sheet:RP00293
