Recombinant Human SLAMF7/CRACC/CD319 Protein
Product Sizes
20 ug
£157.00
RP00292-20UG
100 ug
£336.00
RP00292-100UG
About this Product
- SKU:
- RP00292
- Additional Names:
- SLAMF7,19A,CD319,CRACC,CS1
- Extra Details:
- Recombinant Human SLAMF7/CRACC/CD319 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ser23-Met226) of human SLAMF7/CD319 (Accession #NP_067004.3) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Ser23-Met226
- Molecular Weight:
- 23.23 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSM
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00292
