Recombinant Human Fc-gamma RIII beta/FCGR3B/CD16b Protein
Product Sizes
10 ug
£145.00
RP00291-10UG
20 ug
£193.00
RP00291-20UG
50 ug
£288.00
RP00291-50UG
100 ug
£431.00
RP00291-100UG
About this Product
- SKU:
- RP00291
- Additional Names:
- FCGR3B,CD16,CD16b,FCG3,FCGR3,FCR-10,FCRIII,FCRIIIb
- Extra Details:
- Recombinant Human Fc-gamma RIII beta/FCGR3B/CD16b Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr20-Gln208) of human Fc gamma RIIIB/CD16b (Accession #NP_000561.3) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Thr20-Gln208
- Molecular Weight:
- 22.21 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- TEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNENLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00291








