Recombinant Human VSIG4 Protein
Product Sizes
20 ug
£181.00
RP00286-20UG
50 ug
£240.00
RP00286-50UG
100 ug
£353.00
RP00286-100UG
About this Product
- SKU:
- RP00286
- Additional Names:
- CRIg,Z39IG,VSIG4,VSIG4,CRIg,Z39IG,VSIG4
- Extra Details:
- Recombinant Human VSIG4 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Arg20-Pro283) of human VSIG4 (Accession #NP_009199.1) fused with an Fc, 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Arg20-Pro283
- Molecular Weight:
- 55.97 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00286




