Recombinant Human TNFRSF10B/DR5/TRAIL-R2/CD262 Protein
Product Sizes
10 ug
£115.00
RP00282-10UG
20 ug
£145.00
RP00282-20UG
50 ug
£193.00
RP00282-50UG
100 ug
£276.00
RP00282-100UG
About this Product
- SKU:
- RP00282
- Additional Names:
- CD262,DR5,KILLER,KILLER/DR5,TRAIL-R2,TRAILR2,TRICK2,TRICK2A,TRICK2B,TRICKB,ZTNFR9,TNFRSF10B
- Extra Details:
- Recombinant Human TNFRSF10B/DR5/TRAIL-R2/CD262 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ile 56 - Glu 182) of human DR5 (Accession #NP_003833.3) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Ile56-Glu182
- Molecular Weight:
- 15.13 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00282
