Recombinant Human NKAT-2/KIR2DL3/CD158b2 Protein
Product Sizes
20 ug
£181.00
RP00277-20UG
50 ug
£240.00
RP00277-50UG
100 ug
£353.00
RP00277-100UG
About this Product
- SKU:
- RP00277
- Additional Names:
- KIR2DL3,CD158B2,CD158b,GL183,KIR-023GB,KIR-K7b,KIR-K7c,KIR2DS5,KIRCL23,NKAT,NKAT2,NKAT2A,NKAT2B,p58
- Extra Details:
- Recombinant Human NKAT-2/KIR2DL3/CD158b2 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (His22-His245) of human KIR2DL3/CD158b2 (Accession #NP_056952.2) fused with an Fc, 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- His22-His245
- Molecular Weight:
- 51.38 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWLSPTEPSSETGNPRHLH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00277
