Recombinant Human TNFRSF9/4-1BB/CD137 Protein
Product Sizes
50 ug
£240.00
RP00276-50UG
100 ug
£336.00
RP00276-100UG
About this Product
- SKU:
- RP00276
- Additional Names:
- TNFRSF9,4-1BB,CD137,CDw137,ILA
- Extra Details:
- Recombinant Human TNFRSF9/4-1BB/CD137 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Leu 24 - Gln 186) of human 4-1BB/CD137 (Accession #NP_001552) fused with an Fc, 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Leu24-Gln186
- Molecular Weight:
- 44.07 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00276
