Recombinant Human ICAM-1/CD54 Protein
Product Sizes
10 ug
£133.00
RP00272-10UG
20 ug
£181.00
RP00272-20UG
50 ug
£240.00
RP00272-50UG
100 ug
£353.00
RP00272-100UG
500 ug
£1002.00
RP00272-500UG
1000 ug
£1574.00
RP00272-1000UG
About this Product
- SKU:
- RP00272
- Additional Names:
- BB2,CD54,P3.58,ICAM1
- Extra Details:
- This protein is a cell surface glycoprotein which is typically expressed on endothelial cells and cells of the immune system. It binds to integrins of type CD11a / CD18, or CD11b / CD18 and is also exploited by Rhinovirus as a receptor. ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). During leukocyte trans-endothelial migration, ICAM1 engagement promotes the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activation.
- Formulation:
- Recombinant Human ICAM-1/CD54 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gln28-Glu480) of human ICAM-1/CD54 (Accession #NP_000192.2) fused with a 6
- Immunogen:
- Gln28-Glu480
- Molecular Weight:
- 70-80 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00272
