Recombinant Human IL-6RA/CD126 Protein
Product Sizes
20 ug
£193.00
RP00269-20UG
50 ug
£264.00
RP00269-50UG
100 ug
£395.00
RP00269-100UG
About this Product
- SKU:
- RP00269
- Additional Names:
- IL6R,CD126,IL-6R-1,IL-6RA,IL6Q,IL6RA,IL6RQ,gp80
- Extra Details:
- Recombinant Human IL-6RA/CD126 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu20-Asp358) of human IL-6 R alpha (Accession #NP_000556.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Leu20-Asp358
- Molecular Weight:
- 38.71 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 90 % as determined by SDS-PAGE;≥ 90 %
- Sequence:
- LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00269
