Recombinant Human NKG2D ligand 2/ULBP2 Protein
Product Sizes
10 ug
£127.00
RP00267-10UG
20 ug
£157.00
RP00267-20UG
50 ug
£223.00
RP00267-50UG
100 ug
£336.00
RP00267-100UG
About this Product
- SKU:
- RP00267
- Additional Names:
- ULBP2,ALCAN-alpha,N2DL2,NKG2DL2,RAET1H
- Extra Details:
- Recombinant Human NKG2D ligand 2/ULBP2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly26-Ser217) of human ULBP2 (Accession #NP_079493.1) fused with an Fc, 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Gly26-Ser217
- Molecular Weight:
- 48.52 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- GRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00267
