Recombinant Human LMIR1/CD300a Protein
Product Sizes
10 ug
£133.00
RP00265-10UG
20 ug
£181.00
RP00265-20UG
50 ug
£240.00
RP00265-50UG
100 ug
£353.00
RP00265-100UG
About this Product
- SKU:
- RP00265
- Additional Names:
- CD300A,CLM-8,CMRF-35-H9,CMRF-35H,CMRF35-H,CMRF35-H9,CMRF35H,CMRF35H9,IGSF12,IRC1,IRC1/IRC2,IRC2,IRp60
- Extra Details:
- Recombinant Human LMIR1/CD300a Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Leu 18 - Gln 178 ) of human CD300A (Accession #NP_009192.2) fused with an Fc, 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Leu18-Gln178
- Molecular Weight:
- 44.23 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- LSKCRTVAGPVGGSLSVQCPYEKEHRTLNKYWCRPPQIFLCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPVVEVEVSVFPASTSMTPASITAAKTSTITTAFPPVSSTTLFAVGATHSASIQEETEEVVNSQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00265
