Recombinant Human LMIR2/CD300c Protein
Product Sizes
10 ug
£127.00
RP00264-10UG
20 ug
£175.00
RP00264-20UG
50 ug
£240.00
RP00264-50UG
100 ug
£336.00
RP00264-100UG
About this Product
- SKU:
- RP00264
- Additional Names:
- CD300C,CLM-6,CMRF-35,CMRF-35A,CMRF35,CMRF35-A1,CMRF35A,CMRF35A1,IGSF16,LIR
- Extra Details:
- Recombinant Human LMIR2/CD300c Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly 21 - Arg 183 ) of human CD300C (Accession #NP_006669.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Gly21-Arg183
- Molecular Weight:
- 18.69 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- GYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00264
