Recombinant Human LFA-3/CD58 Protein
Product Sizes
20 ug
£181.00
RP00257-20UG
50 ug
£240.00
RP00257-50UG
100 ug
£353.00
RP00257-100UG
About this Product
- SKU:
- RP00257
- Additional Names:
- CD58, LFA-3, LFA3, ag3, CD58 molecule,LFA-3,LFA3,ag3
- Extra Details:
- Recombinant Human LFA-3/CD58 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Phe 29 - Arg 215 ) of human CD58 (Accession #BC005930) fused with an Fc, 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Phe29-Arg215
- Molecular Weight:
- 48.25 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEYYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00257
