Recombinant Human Growth hormone receptor/GHR Protein
Product Sizes
100 ug
£353.00
RP00251-100UG
About this Product
- SKU:
- RP00251
- Additional Names:
- GHR,GHBP,GHIP
- Extra Details:
- Recombinant Human Growth hormone receptor/GHR Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ala 27 - Tyr 264 ) of human Growth Hormone Receptor (GHR) (Accession #NP_000154.1) fused with an Fc, 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Ala27-Tyr264
- Molecular Weight:
- 54.46 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- AILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFY
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00251








