Recombinant Human Arginase 1/ARG1 Protein
Product Sizes
10 ug
£193.00
RP00247-10UG
20 ug
£258.00
RP00247-20UG
50 ug
£383.00
RP00247-50UG
100 ug
£586.00
RP00247-100UG
About this Product
- SKU:
- RP00247
- Additional Names:
- ARG1, arginase-1,arginase-1
- Extra Details:
- Recombinant Human Arginase 1/ARG1 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Met 1 - Lys 322 ) of human Arginase (Accession #NP_000036.2) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Met1-Lys322
- Molecular Weight:
- 35.57 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP00247
