Recombinant Human Arginase 1/ARG1 Protein
Product Sizes
10 ug
£193.00
RP00247-10UG
20 ug
£258.00
RP00247-20UG
50 ug
£383.00
RP00247-50UG
100 ug
£586.00
RP00247-100UG
500 ug
£1716.00
RP00247-500UG
1000 ug
£2716.00
RP00247-1000UG
About this Product
- SKU:
- RP00247
- Additional Names:
- ARG1, arginase-1,arginase-1
- Extra Details:
- Arg1 also known as liver arginase, is a binuclear manganese metalloenzyme. It is a key enzyme of the urea cycle that catalyses the conversion of L-arginine into L-ornithine and urea, the final cytosolic reaction of urea formation in the mammalian liver. Arginase 1 is abundantly expressed in liver, but it is also expressed in cells and tissues that lack a complete urea cycle, including lung. Arginase is a critical regulator of nitric oxide synthesis and vascular function. It is implicated in a variety of human diseases including vascular disease, pulmonary disease, infectious disease, immune cell function and cancer. In humans, hereditary defects in arginase result in an accumulation of arginine in the blood known as hyperarginemia. Arginase deficiency can also result in the accumulation of nitrogen in the form of ammonia, which results in hyperammonemia.
- Formulation:
- Recombinant Human Arginase 1/ARG1 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Met 1 - Lys 322 ) of human Arginase (Accession #NP_000036.2) fused wit
- Immunogen:
- Met1-Lys322
- Molecular Weight:
- 40 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP00247
