Recombinant Human Cystatin-M/CST6 Protein
Product Sizes
10 ug
£163.00
RP00236-10UG
20 ug
£223.00
RP00236-20UG
50 ug
£336.00
RP00236-50UG
500 ug
£1478.00
RP00236-500UG
1000 ug
£2335.00
RP00236-1000UG
About this Product
- SKU:
- RP00236
- Additional Names:
- CST6
- Extra Details:
- Cystatin E/M encoded by the CST6 gene is a member of family 2 of the cystatin superfamily. It inhibits papain and cathepsin B, two of the cysteine proteases. Its mRNA was found in many tissues by the two groups who did initial cloning. However, its protein was found only in skin and sweat glands by a third group. In addition to being a cysteine protease inhibitor, cystatin E/M is also a substrate for transglutaminases. It is required for viability and for correct formation of cornified layers in the epidermis and hair follicles, as ichq mice, with a null mutation in the cystatin E/M gene, have defects in epidermal cornification and die between 5 and 12 days of age. Cystatin E/M expression and function may not be limited to cutaneous epithelia. For example, it is found in rat brain and is induced during neuronal cell differentiation.
- Formulation:
- Recombinant Human Cystatin-M/CST6 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Arg29-Met149) of human CST6 (Accession #NP_001314.1) fused with a 6xHi
- Immunogen:
- Arg29-Met149
- Molecular Weight:
- 15, 17 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- RPQERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQM
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00236


