Recombinant Human Cystatin-M/CST6 Protein
Product Sizes
10 ug
£163.00
RP00236-10UG
20 ug
£223.00
RP00236-20UG
50 ug
£336.00
RP00236-50UG
About this Product
- SKU:
- RP00236
- Additional Names:
- CST6
- Extra Details:
- Recombinant Human Cystatin-M/CST6 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Arg29-Met149) of human CST6 (Accession #NP_001314.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Arg29-Met149
- Molecular Weight:
- 14.43 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- RPQERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQM
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00236
