Recombinant Human Kallikrein-8/KLK8 Protein
Product Sizes
10 ug
£193.00
RP00226-10UG
50 ug
£383.00
RP00226-50UG
100 ug
£586.00
RP00226-100UG
About this Product
- SKU:
- RP00226
- Additional Names:
- KLK8, HNP, NP, NRPN, PRSS19, TADG14, kallikrein-8,Kallikrein 8,HNP,NP,NRPN,PRSS19,TADG14
- Extra Details:
- Recombinant Human Kallikrein-8/KLK8 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln29-Gly260) of human KLK-8/Kallikrein-8 (Accession #NP_009127.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 20mM Tris,150mM NaCl, pH 8.0.Contact us for customized product form or formulation.
- Immunogen:
- Gln29-Gly260
- Molecular Weight:
- 25.80 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QEDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHCKKPKYTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP00226
