Recombinant Human IFN-lambda 3/IL-28B Protein
Product Sizes
10 ug
£145.00
RP00219-10UG
20 ug
£193.00
RP00219-20UG
About this Product
- SKU:
- RP00219
- Additional Names:
- IFNL3,IFN-lambda-3,IFN-lambda-4,IL-28B,IL-28C,IL28B,IL28C
- Extra Details:
- Recombinant Human IFN-lambda 3/IL-28B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Val196) of human IFNL3/IL28B/Interleukin-28B (Accession #NP_742151.2) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS,500mM NaCl, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Met1-Val196
- Molecular Weight:
- 23.39 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MTGDCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00219
