Recombinant Human Osteonectin/SPARC Protein
Product Sizes
10 ul
£115.00
RP00217-10UL
20 ug
£145.00
RP00217-20UG
50 ug
£193.00
RP00217-50UG
100 ug
£276.00
RP00217-100UG
500 ug
£764.00
RP00217-500UG
1000 ug
£1193.00
RP00217-1000UG
About this Product
- SKU:
- RP00217
- Additional Names:
- SPARC,BM-40,OI17
- Extra Details:
- SPARC (secreted protein acidic and rich in cysteine), also known as osteonectin and BM40, is a secreted matricellular glycoprotein . SPARC is produced by fibroblasts, capillary endothelial cells, platelets and macrophages, especially in areas of tissue morphogenesis and remodeling.SPARC is involved in tissue renewal, tissue remodeling, and embryonic development and work by exerting counter-adhesive and antiproliferative effects that lead to changes in cell shape, disruption of cell adhesion, and inhibition of the cell cycle. SPARC is abundantly expressed in bone where it promotes osteoblast differentiation and inhibits adipogenesis. SPARC is highly expressed in many tumor types undergoing an endothelial to mesenchymal transistion; its expression, however, mainly decreases the likelihood of metastasis and confers sensitivity to chemotherapy and radiation.SPARC has also been linked with obesity and diabetes.
- Formulation:
- Recombinant Human Osteonectin/SPARC Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala18-Ile303) of human Osteonectin/SPARC (Accession #NP_003109
- Immunogen:
- Ala18-Ile303
- Molecular Weight:
- 37-48 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 90 % as determined by SDS-PAGE;≥ 90 %
- Sequence:
- APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00217
