Recombinant Human Lumican/LUM Protein
Product Sizes
10 ug
£127.00
RP00216-10UG
20 ug
£175.00
RP00216-20UG
50 ug
£240.00
RP00216-50UG
100 ug
£336.00
RP00216-100UG
About this Product
- SKU:
- RP00216
- Additional Names:
- LDC, SLRR2D,LUM,SLRR2D,lumican
- Extra Details:
- Recombinant Human Lumican/LUM Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln19-Asn338) of human Lumican/LUM (Accession #NP_002336.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Gln19-Asn338
- Molecular Weight:
- 37.50 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00216




