Recombinant Human Lumican/LUM Protein
Product Sizes
10 ug
£127.00
RP00216-10UG
20 ug
£175.00
RP00216-20UG
50 ug
£240.00
RP00216-50UG
100 ug
£336.00
RP00216-100UG
500 ug
£1002.00
RP00216-500UG
1000 ug
£1574.00
RP00216-1000UG
About this Product
- SKU:
- RP00216
- Additional Names:
- LDC, SLRR2D,LUM,SLRR2D,lumican
- Extra Details:
- Lumican is a member of the family of small leucine-rich repeat proteoglycans (SLRPs) and the class II subfamily .which is a major component of the cornea, dermal, and muscle connective tissues. Lumican is the major keratan sulfate proteoglycan of the cornea but is also distributed in interstitial collagenous matrices throughout the body. Lumican regulates collagenous matrix assembly as a keratan sulfate proteoglycan in the cornea and is also present in the connective tissues of other organs and embryonic corneal stroma as a glycoprotein. Lumican may regulate collagen fibril organization and circumferential growth, corneal transparency, and epithelial cell migration and tissue repair. Lumican's over-expression has been reported in carcinoid tumor, breast, colorectal, neuroendocrine, uterine cervical and pancreatic cancers
- Formulation:
- Recombinant Human Lumican/LUM Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln19-Asn338) of human Lumican/LUM (Accession #NP_002336.1) fused wi
- Immunogen:
- Gln19-Asn338
- Molecular Weight:
- 45-60 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00216
