Recombinant Human IL-17A/CTLA-8 Protein
Product Sizes
10 ug
£133.00
RP00212-10UG
20 ug
£181.00
RP00212-20UG
50 ug
£240.00
RP00212-50UG
100 ug
£353.00
RP00212-100UG
About this Product
- SKU:
- RP00212
- Additional Names:
- IL17A, CTLA-8, CTLA8, IL-17, IL-17A, IL17, interleukin-17A,CTLA-8,CTLA8,IL-17,IL-17A,IL17
- Extra Details:
- Recombinant Human IL-17A/CTLA-8 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile20-Ala155) of human IL-17A (Accession #NP_002181.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Ile20-Ala155
- Molecular Weight:
- 16.37 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- IVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00212
