Recombinant Human MMP-1 Protein
Product Sizes
10 ug
£193.00
RP00211-10UG
20 ug
£258.00
RP00211-20UG
50 ug
£384.00
RP00211-50UG
100 ug
£586.00
RP00211-100UG
500 ug
£1716.00
RP00211-500UG
1000 ug
£2716.00
RP00211-1000UG
About this Product
- SKU:
- RP00211
- Additional Names:
- MMP1,CLG,CLGN
- Extra Details:
- MMP1, also known as MMP-1, contains 4 hemopexin-like domains and is a member of the matrix metalloproteinase (MMP) family. Matrix metalloproteases, also called matrixins, are zinc-dependent endopeptidases that are the major proteases involved in ECM degradation. MMPs are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. MMP1 is expressed by fibroblasts, keratinocytes, endothelial cells, monocytes and macrophages.Mutations of MMP1 are associated with chronic obstructive pulmonary disease (COPD).
- Formulation:
- Recombinant Human MMP1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe20-Asn469) of human MMP1 (Accession #NP_002412.1) fused with a 6xHis tag
- Immunogen:
- Phe20-Asn469
- Molecular Weight:
- 55-60 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- FPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP00211


