Recombinant Human Podoplanin/PDPN Protein
Product Sizes
10 ug
£133.00
RP00208-10UG
20 ug
£181.00
RP00208-20UG
50 ug
£240.00
RP00208-50UG
100 ug
£353.00
RP00208-100UG
500 ug
£1002.00
RP00208-500UG
1000 ug
£1574.00
RP00208-1000UG
About this Product
- SKU:
- RP00208
- Additional Names:
- AGGRUS, GP36, GP40, Gp38, HT1A-1, OTS8, PA2.26, T1A, T1A-2, T1A2, TI1A,PDPN, AGGRUS, podoplanin,GP36,GP40,Gp38,HT1A-1,OTS8,PA2.26,T1A,T1A-2,T1A2,TI1A
- Extra Details:
- Podoplanin, also known as glycoprotein 36 (gp36), PA2.26 antigen, T1-alpha (T1A), and aggrus, is a 36 kDa type I transmembrane sialoglycoprotein and member of the Podoplanin family.PDPN is a mucin-type glycoprotein negatively charged by extensive O-glycosylation and a high content of sialic acid, which expresses the adhesive property. It is selectively expressed in lymphatic endothelium as well as lymphangiomas, Kaposi sarcomas, and in a subset of angiosarcomas with probable lymphatic differentiation. PDPN may contribute to form odontoblastic fiber or function as the anchorage to the tooth development and in proliferating epithelial cells of cervical loop and apical bud. The intensity of podoplanin expression is negatively correlated with the expression of CD34 and factor VIII. Podoplanin would be useful as a diagnostic marker for epithelioid hemangioendothelioma in liver tumors.
- Formulation:
- Recombinant Human Podoplanin/PDPN Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu97-Lys199) of human PDPN/Podoplanin (Accession #NP_006465.3)
- Immunogen:
- Glu97-Lys199
- Molecular Weight:
- 50-65 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- EGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00208


