Recombinant Human Podoplanin/PDPN Protein
Product Sizes
10 ug
£133.00
RP00208-10UG
20 ug
£181.00
RP00208-20UG
50 ug
£240.00
RP00208-50UG
100 ug
£353.00
RP00208-100UG
About this Product
- SKU:
- RP00208
- Additional Names:
- AGGRUS, GP36, GP40, Gp38, HT1A-1, OTS8, PA2.26, T1A, T1A-2, T1A2, TI1A,PDPN, AGGRUS, podoplanin,GP36,GP40,Gp38,HT1A-1,OTS8,PA2.26,T1A,T1A-2,T1A2,TI1A
- Extra Details:
- Recombinant Human Podoplanin/PDPN Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu97-Lys199) of human PDPN/Podoplanin (Accession #NP_006465.3) fused with an Fc, 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Glu97-Lys199
- Molecular Weight:
- 37.31 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- EGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00208








