Recombinant Human CD301 Protein
Product Sizes
10 ug
£127.00
RP00207-10UG
20 ug
£175.00
RP00207-20UG
50 ug
£240.00
RP00207-50UG
500 ug
£1002.00
RP00207-500UG
1000 ug
£1574.00
RP00207-1000UG
About this Product
- SKU:
- RP00207
- Additional Names:
- CLEC10A,CD301,CLECSF13,CLECSF14,HML,HML2,MGL
- Extra Details:
- CLEC10A, also known as macrophage galactose/N-acetyl-galactosamine (GalNAc) specific lectin (MGL), CD301, DC-ASGPR, and HML, is a 40 kDa type II transmembrane glycoprotein that belongs to the C-type lectin family. C-type lectin family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. CLEC10A is expressed on macrophages and related cells of myeloid origins, particularly immature dendritic cells (DCs). CLEC10A plays a protective role against colitis by effectively inducing IL-10 production by colonic lamina propria macrophages in response to invading commensal bacteria.
- Formulation:
- Recombinant Human CD301 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln61-His316) of human CLEC10A/MGL1/CD301 (Accession #NP_878910.1) fused w
- Immunogen:
- Gln61-His316
- Molecular Weight:
- Approximately 40 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- QNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00207
