Recombinant Human Angiopoietin-like 7/ANGPTL7(27-346) Protein
Product Sizes
10 ug
£145.00
RP00206-10UG
20 ug
£193.00
RP00206-20UG
50 ug
£288.00
RP00206-50UG
100 ug
£431.00
RP00206-100UG
500 ug
£1240.00
RP00206-500UG
1000 ug
£1954.00
RP00206-1000UG
About this Product
- SKU:
- RP00206
- Additional Names:
- ANGPTL7,AngX,CDT6,dJ647M16.1
- Extra Details:
- Angiopoietin-like 7 (ANGPTL7), also known as Corneal-Derived Transcript 6 (CDT6), is a secreted glycoprotein that is structurally related to the angiopoietins. ANGPTL7 is expressed in the corneal stroma, trabecular meshwork, and sclera and is elevated in glaucoma aqueous humor. Its production is up regulated in trabecular meshwork cells by glucocorticoids and TGF-beta and in cartilage by TNF-alpha. Overexpression of ANGPTL7 in trabecular meshwork cells inhibits the production of collagen and proteoglycans . When overexpressed in tumor cells it promotes collagen and proteoglycan deposition but inhibits tumor xenograft progression and tumor angiogenesis.
- Formulation:
- Recombinant Human Angiopoietin-like 7/ANGPTL7(27-346) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln27-Pro346) of human Angiopoietin-like 7 (
- Immunogen:
- Gln27-Pro346
- Molecular Weight:
- 35-45,45-60kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00206
